PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_047ABC9FC.1
Common NameNFYA-A2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 130aa    MW: 14578.7 Da    PI: 10.8554
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_047ABC9FC.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA100.31.9e-3165121158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            d+p+YVNaKQy++Il+RR +Rak+e+e++l  k+rkpylheSRh+hA+rR+Rg+gGrF
  Traes_5AL_047ABC9FC.1  65 DAPIYVNAKQYEGILRRRRARAKVERENQL-VKGRKPYLHESRHRHAMRRARGTGGRF 121
                            68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.1E-3463124IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.17264124IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.6E-2867121IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.0E-246789IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.0E-2498121IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MEHSATIALQ SPLPEYNSRF EFGPGPSMMS SGYPSAEQCY GLLTTYAMKS TPGGRLLLPL  60
NATADAPIYV NAKQYEGILR RRRARAKVER ENQLVKGRKP YLHESRHRHA MRRARGTGGR  120
FLNTKKEGNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-2065129266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105114RHRHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0787490.0KM078749.1 Triticum aestivum CCAAT-binding transcription factor B (NFYA-A2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561845.12e-71PREDICTED: nuclear transcription factor Y subunit A-10-like
SwissprotQ8LFU01e-31NFYAA_ARATH; Nuclear transcription factor Y subunit A-10
TrEMBLA0A0A7LWR82e-90A0A0A7LWR8_WHEAT; CCAAT-binding transcription factor B
TrEMBLW5EU984e-92W5EU98_WHEAT; Uncharacterized protein
STRINGBRADI1G13680.15e-71(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.13e-25nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Qu B, et al.
    A wheat CCAAT box-binding transcription factor increases the grain yield of wheat with less fertilizer input.
    Plant Physiol., 2015. 167(2): p. 411-23
    [PMID:25489021]